PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA031505-PA
Common NameOsI_34441
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 315aa    MW: 34051.6 Da    PI: 5.7415
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA031505-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.81.1e-081712201362
                       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ + ++
  BGIOSGA031505-PA 171 NRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGMATQ 220
                       *************************************9999887766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-10162223IPR004827Basic-leucine zipper domain
CDDcd147034.12E-19168213No hitNo description
SuperFamilySSF579594.85E-9169213No hitNo description
PfamPF001702.0E-7170221IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.99171224IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.2E-9171218No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MDDTARGGLL PPRKAHRRSR SDVPFGYFQP LPPPSPKMEA GGGWALPGCG GAGDVDLLNA  60
YMSLEGMGGA DGLNNSDGDS RGSSMRTNGA DSSENESEDY VGADSQALLW GGAGGGEAAG  120
KKRRNNAAGE TAARHARSLS MDSLMGKLSF AANGEPAKFS LEFGSGEVLA NRQSAARSKE  180
RRMRYIAELE QKVQILQTEA TTLSAQLTLL QRDSSGMATQ NNELKFRLQS MEQQAQLRDA  240
LNEALTAEVQ RLKLAANEVG DTSSSSNLAH QIQLRCQNQM LDLHKQQQQQ VEQIPFYQLE  300
QPEQQNGTAR NHESK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.468360.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329938160.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126180.0CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613793.10.0PREDICTED: transcription factor RF2a-like
TrEMBLB8BHZ60.0B8BHZ6_ORYSI; Uncharacterized protein
STRINGBGIOSGA031505-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-43bZIP family protein